Recombinant Human ENC1, His-tagged
Cat.No. : | ENC1-28558TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 261-582 of Human ENC1 with N terminal His tag; 322 amino acids, 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 261-582 a.a. |
Description : | DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. |
Conjugation : | HIS |
Tissue specificity : | Detected in fetal brain tissue, moderate expression in fetal heart, lung and kidney. Highly expressed in adult brain, particularly high in the hippocampus and amygdala, and spinal chord. Detectable in adult pancreas. |
Form : | Lyophilised:Reconstitute with 117 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAI GCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLV ARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEH YDPTINKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSV SHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGN QIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMS CHAVASGNKLYVVGGYFGIQRCKTLDCYDPTLDVWNSITT VPYSLIPTAFVS |
Sequence Similarities : | Contains 1 BTB (POZ) domain.Contains 6 Kelch repeats. |
Gene Name | ENC1 ectodermal-neural cortex 1 (with BTB-like domain) [ Homo sapiens ] |
Official Symbol | ENC1 |
Synonyms | ENC1; ectodermal-neural cortex 1 (with BTB-like domain); NRPB; ectoderm-neural cortex protein 1; ENC 1; kelch like 37 (Drosophila); KLHL37; PIG10; TP53I10; |
Gene ID | 8507 |
mRNA Refseq | NM_003633 |
Protein Refseq | NP_003624 |
MIM | 605173 |
Uniprot ID | O14682 |
Chromosome Location | 5q13 |
Function | actin binding; |
◆ Recombinant Proteins | ||
ENC1-2787M | Recombinant Mouse ENC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENC1-5156H | Recombinant Human ENC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENC1-28558TH | Recombinant Human ENC1, His-tagged | +Inquiry |
ENC1-3302H | Recombinant Human ENC1 Protein, GST-tagged | +Inquiry |
ENC1-207Z | Recombinant Zebrafish ENC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENC1-6603HCL | Recombinant Human ENC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENC1 Products
Required fields are marked with *
My Review for All ENC1 Products
Required fields are marked with *