Recombinant Human ENTPD3 ENTPD3-28572TH

Recombinant Human ENTPD3

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ENTPD3

Recombinant Human ENTPD3

ENTPD3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ENTPD3-28572TH
Product Overview : Recombinant full length Human ENTPD3 with N terminal proprietary tag. Predicted MW 75.79 kDa.
Description : ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases.
Protein length : 452 amino acids
Molecular Weight : 75.790kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSI TVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKE NNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKV KGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESI QSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEK NLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTS DIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSP TKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPN DVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQ PKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCS QNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTE ETWPQIHFEKEE
Sequence Similarities : Belongs to the GDA1/CD39 NTPase family.
Gene Name : ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens ]
Official Symbol : ENTPD3
Synonyms : ENTPD3; ectonucleoside triphosphate diphosphohydrolase 3; CD39L3; HB6; NTPDase 3;
Gene ID : 956
mRNA Refseq : NM_001248
Protein Refseq : NP_001239
MIM : 603161
Uniprot ID : O75355
Chromosome Location : 3p21.3
Pathway : Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function : ATP binding; hydrolase activity; nucleotide binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy