"ESRRG" Related Products

Expand
Expand

Recombinant Human ESRRG

Cat.No.: ESRRG-28703TH
Product Overview: Recombinant full length Human Estrogen Related Receptor gamma with N terminal proprietary tag; predicted MWt: 74.73 kDa including the tag.
Description: This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5 end and some of which encode protein isoforms differing in the N-terminal region.
Protein length: 442 amino acids
Molecular Weight: 74.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGS SDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLY DDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYG VASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ ACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPY LNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPD PTAPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSL ADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDE DQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIAL ANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRA GKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLLLEML EAKV
Sequence Similarities: Belongs to the nuclear hormone receptor family. NR3 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name: ESRRG estrogen-related receptor gamma [ Homo sapiens ]
Official Symbol: ESRRG
Synonyms: ESRRG; estrogen-related receptor gamma;
Gene ID: 2104
mRNA Refseq: NM_001243505
Protein Refseq: NP_001230434
MIM: 602969
Uniprot ID: P62508
Chromosome Location: 1q41
Pathway: Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem;
Function: AF-2 domain binding; metal ion binding; receptor activity; retinoic acid receptor activity; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.