"ETV5" Related Products

Expand
Expand

Recombinant Human ETV5

Cat.No.: ETV5-26229TH
Product Overview: Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name: ETV5 ets variant 5 [ Homo sapiens ]
Official Symbol: ETV5
Synonyms: ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule;
Gene ID: 2119
mRNA Refseq: NM_004454
Protein Refseq: NP_004445
MIM: 601600
Uniprot ID: P41161
Chromosome Location: 3q28
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.