Recombinant Full Length Human ETV5 Protein, GST-tagged
Cat.No. : | ETV5-4371HF |
Product Overview : | Human ETV5 full-length ORF (AAH07333.1, 1 a.a. - 510 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 510 amino acids |
Description : | ETV5 (ETS Variant 5) is a Protein Coding gene. Diseases associated with ETV5 include Sertoli Cell-Only Syndrome. Among its related pathways are FOXM1 transcription factor networkand IL12-mediated signaling events. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription regulatory region DNA binding. An important paralog of this gene is ETV1. |
Molecular Mass : | 84.2 kDa |
AA Sequence : | MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETV5 ets variant 5 [ Homo sapiens ] |
Official Symbol | ETV5 |
Synonyms | ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule; ets-related molecule; ets-related protein ERM; |
Gene ID | 2119 |
mRNA Refseq | NM_004454 |
Protein Refseq | NP_004445 |
MIM | 601600 |
UniProt ID | P41161 |
◆ Recombinant Proteins | ||
ETV5-4371HF | Recombinant Full Length Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-3278H | Recombinant Human ETV5 Protein (Ser160-Tyr510), N-His tagged | +Inquiry |
ETV5-194H | Recombinant Human ETV5 protein, T7/His-tagged | +Inquiry |
ETV5-2883M | Recombinant Mouse ETV5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV5-6520HCL | Recombinant Human ETV5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV5 Products
Required fields are marked with *
My Review for All ETV5 Products
Required fields are marked with *
0
Inquiry Basket