Recombinant Human EXOC7, His-tagged
Cat.No. : | EXOC7-28334TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 361-653 of Human EXOC7 isoform 2 with N terminal His tag; 293 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADN IKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETA GAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQL NLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVA VTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLP VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWA IPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA |
Sequence Similarities : | Belongs to the EXO70 family. |
Gene Name : | EXOC7 exocyst complex component 7 [ Homo sapiens ] |
Official Symbol : | EXOC7 |
Synonyms : | EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; |
Gene ID : | 23265 |
mRNA Refseq : | NM_001013839 |
Protein Refseq : | NP_001013861 |
MIM : | 608163 |
Uniprot ID : | Q9UPT5 |
Chromosome Location : | 17q25.3 |
Pathway : | Arf6 trafficking events, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Pathway, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
EXOC7-1827R | Recombinant Rat EXOC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EXOC7-2899M | Recombinant Mouse EXOC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Exoc7-2888M | Recombinant Mouse Exoc7 Protein, Myc/DDK-tagged | +Inquiry |
EXOC7-2030C | Recombinant Chicken EXOC7 | +Inquiry |
EXOC7-283H | Recombinant Human EXOC7, GST-tagged | +Inquiry |
◆ Lysates | ||
EXOC7-6507HCL | Recombinant Human EXOC7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket