"EXOC7" Related Products

Expand
Expand
Expand

Recombinant Human EXOC7, His-tagged

Cat.No.: EXOC7-28334TH
Product Overview: Recombinant fragment, corresponding to amino acids 361-653 of Human EXOC7 isoform 2 with N terminal His tag; 293 amino acids, 35kDa.
Description: EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 63 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADN IKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETA GAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQL NLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVA VTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLP VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWA IPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA
Sequence Similarities: Belongs to the EXO70 family.
Gene Name: EXOC7 exocyst complex component 7 [ Homo sapiens ]
Official Symbol: EXOC7
Synonyms: EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W;
Gene ID: 23265
mRNA Refseq: NM_001013839
Protein Refseq: NP_001013861
MIM: 608163
Uniprot ID: Q9UPT5
Chromosome Location: 17q25.3
Pathway: Arf6 trafficking events, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Pathway, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.