Recombinant Human FCGR1A, Fc-tagged

• Cat.No.: FCGR1A-27573TH
• Product Overview: Recombinant fragment corresponding to aa 16 - 115 of Human FCGR1A with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Fc
• Protein Length: 100 amino acids
• Description: This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
• Conjugation: Fc
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Monocyte/macrophage specific.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
• Sequence Similarities: Belongs to the immunoglobulin superfamily. FCGR1 family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ]
• Official Symbol: FCGR1A
• Synonyms: FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A
• Gene ID: 2209
• mRNA Refseq: NM_000566
• Protein Refseq: NP_000557
• MIM: 146760
• Uniprot ID: P12314
• Chromosome Location: 1q21.2-q21.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of soluble exogenous antigens (endosomes), organism-specific biosystem
• Function: IgG binding; protein binding; receptor activity; receptor signaling protein activity