"FGD3" Related Products

Recombinant Human FGD3, His-tagged

Cat.No.: FGD3-27710TH
Product Overview: Recombinant fragment, corresponding to amino acids 518-725 of Human FGD3 with N terminal His tag; Predicted MWt 24 kDa.
Description: FYVE, RhoGEF and PH domain-containing protein 3 is a protein that in humans is encoded by the FGD3 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 79 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKL CGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTE KTPTADPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQ VLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHV WKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSP GALQLQVPMGAAAP
Gene Name: FGD3 FYVE, RhoGEF and PH domain containing 3 [ Homo sapiens ]
Official Symbol: FGD3
Synonyms: FGD3; FYVE, RhoGEF and PH domain containing 3; FGD1 family, member 3; FYVE, RhoGEF and PH domain-containing protein 3; FLJ00004; ZFYVE5;
Gene ID: 89846
mRNA Refseq: NM_033086
Protein Refseq: NP_149077
Uniprot ID: Q5JSP0
Chromosome Location: 9q22
Pathway: Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function: Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; metal ion binding; small GTPase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.