Recombinant Human FGD3, His-tagged
Cat.No. : | FGD3-27710TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 518-725 of Human FGD3 with N terminal His tag; Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
Description : | FYVE, RhoGEF and PH domain-containing protein 3 is a protein that in humans is encoded by the FGD3 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 79 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKL CGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTE KTPTADPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQ VLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHV WKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSP GALQLQVPMGAAAP |
Gene Name : | FGD3 FYVE, RhoGEF and PH domain containing 3 [ Homo sapiens ] |
Official Symbol : | FGD3 |
Synonyms : | FGD3; FYVE, RhoGEF and PH domain containing 3; FGD1 family, member 3; FYVE, RhoGEF and PH domain-containing protein 3; FLJ00004; ZFYVE5; |
Gene ID : | 89846 |
mRNA Refseq : | NM_033086 |
Protein Refseq : | NP_149077 |
Uniprot ID : | Q5JSP0 |
Chromosome Location : | 9q22 |
Pathway : | Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function : | Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; metal ion binding; small GTPase binding; |
Products Types
◆ Recombinant Protein | ||
FGD3-4090H | Recombinant Human FGD3 Protein, GST-tagged | +Inquiry |
FGD3-12859H | Recombinant Human FGD3, GST-tagged | +Inquiry |
◆ Lysates | ||
FGD3-619HCL | Recombinant Human FGD3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket