Recombinant Human FGD3, His-tagged
Cat.No. : | FGD3-27710TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 518-725 of Human FGD3 with N terminal His tag; Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 518-725 a.a. |
Description : | FYVE, RhoGEF and PH domain-containing protein 3 is a protein that in humans is encoded by the FGD3 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 79 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKL CGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTE KTPTADPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQ VLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHV WKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSP GALQLQVPMGAAAP |
Gene Name | FGD3 FYVE, RhoGEF and PH domain containing 3 [ Homo sapiens ] |
Official Symbol | FGD3 |
Synonyms | FGD3; FYVE, RhoGEF and PH domain containing 3; FGD1 family, member 3; FYVE, RhoGEF and PH domain-containing protein 3; FLJ00004; ZFYVE5; |
Gene ID | 89846 |
mRNA Refseq | NM_033086 |
Protein Refseq | NP_149077 |
Uniprot ID | Q5JSP0 |
Chromosome Location | 9q22 |
Pathway | Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; NRAGE signals death through JNK, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function | Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; metal ion binding; small GTPase binding; |
◆ Recombinant Proteins | ||
FGD3-12859H | Recombinant Human FGD3, GST-tagged | +Inquiry |
FGD3-4090H | Recombinant Human FGD3 Protein, GST-tagged | +Inquiry |
FGD3-4789HF | Recombinant Full Length Human FGD3 Protein, GST-tagged | +Inquiry |
FGD3-27710TH | Recombinant Human FGD3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGD3-619HCL | Recombinant Human FGD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGD3 Products
Required fields are marked with *
My Review for All FGD3 Products
Required fields are marked with *