Recombinant Human FKBP1B, His-tagged

• Cat.No.: FKBP1B-28914TH
• Product Overview: Recombinant full-length Human FKBP1B with a N terminal His tag. 130 amino acids with a predicted MWt 14.2 kDa including tag.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
• Protein length: 108 amino acids
• Conjugation: HIS
• Molecular Weight: 14.200kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Isoform 1 and isoform 2 are Ubiquitous with highest levels in brain and thymus.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPK KGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIK GFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATL IFDVELLNLE
• Sequence Similarities: Belongs to the FKBP-type PPIase family. FKBP1 subfamily.Contains 1 PPIase FKBP-type domain.

Gene Information

• Gene Name: FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ]
• Official Symbol: FKBP1B
• Synonyms: FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD) , FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase
• Gene ID: 2281
• mRNA Refseq: NM_004116
• Protein Refseq: NP_004107
• MIM: 600620
• Uniprot ID: P68106
• Chromosome Location: 2p23.3
• Function: FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; receptor binding