"FKBP1B" Related Products

Expand
Expand

Recombinant Human FKBP1B, His-tagged

Cat.No.: FKBP1B-28914TH
Product Overview: Recombinant full-length Human FKBP1B with a N terminal His tag. 130 amino acids with a predicted MWt 14.2 kDa including tag.
Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Protein length: 108 amino acids
Conjugation: HIS
Molecular Weight: 14.200kDa inclusive of tags
Source: E. coli
Tissue specificity: Isoform 1 and isoform 2 are Ubiquitous with highest levels in brain and thymus.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPK KGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIK GFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATL IFDVELLNLE
Sequence Similarities: Belongs to the FKBP-type PPIase family. FKBP1 subfamily.Contains 1 PPIase FKBP-type domain.
Gene Name: FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ]
Official Symbol: FKBP1B
Synonyms: FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD) , FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase;
Gene ID: 2281
mRNA Refseq: NM_004116
Protein Refseq: NP_004107
MIM: 600620
Uniprot ID: P68106
Chromosome Location: 2p23.3
Function: FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.