Recombinant Human FKBP1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FKBP1B-1346H |
Product Overview : | FKBP1B MS Standard C13 and N15-labeled recombinant protein (NP_473374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. |
Molecular Mass : | 8.8 kDa |
AA Sequence : | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FKBP1B FKBP prolyl isomerase 1B [ Homo sapiens (human) ] |
Official Symbol | FKBP1B |
Synonyms | FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD), FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; FKBP-1B; rotamase; FKBP-12.6; h-FKBP-12; calstabin 2; 12.6 kDa FKBP; PPIase FKBP1B; immunophilin FKBP12.6; FK506-binding protein 1B; FK506-binding protein 12.6; 12.6 kDa FK506-binding protein; FKBP1L; PKBP1L; |
Gene ID | 2281 |
mRNA Refseq | NM_054033 |
Protein Refseq | NP_473374 |
MIM | 600620 |
UniProt ID | P68106 |
◆ Recombinant Proteins | ||
FKBP1B-2187C | Recombinant Cattle FKBP1B Protein, His-tagged | +Inquiry |
FKBP1B-5252H | Recombinant Human FKBP1B Protein | +Inquiry |
FKBP1B-001H | Recombinant Human FKBP1B Protein | +Inquiry |
FKBP1B-28914TH | Recombinant Human FKBP1B, His-tagged | +Inquiry |
FKBP1B-6136C | Recombinant Chicken FKBP1B | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1B Products
Required fields are marked with *
My Review for All FKBP1B Products
Required fields are marked with *