Recombinant Human FKBP1B, His-tagged
Cat.No. : | FKBP1B-28914TH |
Product Overview : | Recombinant full-length Human FKBP1B with a N terminal His tag. 130 amino acids with a predicted MWt 14.2 kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. |
Protein length : | 108 amino acids |
Conjugation : | HIS |
Molecular Weight : | 14.200kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Isoform 1 and isoform 2 are Ubiquitous with highest levels in brain and thymus. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPK KGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIK GFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATL IFDVELLNLE |
Sequence Similarities : | Belongs to the FKBP-type PPIase family. FKBP1 subfamily.Contains 1 PPIase FKBP-type domain. |
Gene Name : | FKBP1B FK506 binding protein 1B, 12.6 kDa [ Homo sapiens ] |
Official Symbol : | FKBP1B |
Synonyms : | FKBP1B; FK506 binding protein 1B, 12.6 kDa; FK506 binding protein 1B (12.6 kD) , FKBP1L; peptidyl-prolyl cis-trans isomerase FKBP1B; FKBP9; FKBP12.6; OTK4; PPIase; |
Gene ID : | 2281 |
mRNA Refseq : | NM_004116 |
Protein Refseq : | NP_004107 |
MIM : | 600620 |
Uniprot ID : | P68106 |
Chromosome Location : | 2p23.3 |
Function : | FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; receptor binding; |
Products Types
◆ Recombinant Protein | ||
FKBP1B-4187H | Recombinant Human FKBP1B Protein, GST-tagged | +Inquiry |
FKBP1B-2010R | Recombinant Rat FKBP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1B-001H | Recombinant Human FKBP1B Protein | +Inquiry |
FKBP1B-1541R | Recombinant Rhesus Macaque FKBP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1B-5252H | Recombinant Human FKBP1B Protein | +Inquiry |
◆ Lysates | ||
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket