"FOXD2" Related Products

Recombinant Human FOXD2

Cat.No.: FOXD2-28109TH
Product Overview: Recombinant fragment of Human FOXD2 (amino acids 411-494) with a N terminal proprietary tag; Predicted MWt 34.87 kDa including the tag.
Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined.
Protein length: 84 amino acids
Molecular Weight: 34.870kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Kidney specific.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
Sequence Similarities: Contains 1 fork-head DNA-binding domain.
Gene Name: FOXD2 forkhead box D2 [ Homo sapiens ]
Official Symbol: FOXD2
Synonyms: FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9;
Gene ID: 2306
mRNA Refseq: NM_004474
Protein Refseq: NP_004465
MIM: 602211
Uniprot ID: O60548
Chromosome Location: 1p34-p32
Function: DNA bending activity; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.