Recombinant Human FOXD2
Cat.No. : | FOXD2-28109TH |
Product Overview : | Recombinant fragment of Human FOXD2 (amino acids 411-494) with a N terminal proprietary tag; Predicted MWt 34.87 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 84 amino acids |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined. |
Molecular Weight : | 34.870kDa inclusive of tags |
Tissue specificity : | Kidney specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH |
Sequence Similarities : | Contains 1 fork-head DNA-binding domain. |
Gene Name | FOXD2 forkhead box D2 [ Homo sapiens ] |
Official Symbol | FOXD2 |
Synonyms | FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9; |
Gene ID | 2306 |
mRNA Refseq | NM_004474 |
Protein Refseq | NP_004465 |
MIM | 602211 |
Uniprot ID | O60548 |
Chromosome Location | 1p34-p32 |
Function | DNA bending activity; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
FOXD2-5983M | Recombinant Mouse FOXD2 Protein | +Inquiry |
FOXD2-582H | Recombinant Human FOXD2 | +Inquiry |
Foxd2-1514M | Recombinant Mouse Foxd2 Protein, His&GST-tagged | +Inquiry |
FOXD2-3319M | Recombinant Mouse FOXD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXD2-28109TH | Recombinant Human FOXD2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXD2 Products
Required fields are marked with *
My Review for All FOXD2 Products
Required fields are marked with *