"FOXO1" Related Products

Expand
Expand
Expand

Recombinant Human FOXO1, His-tagged

Cat.No.: FOXO1-28946TH
Product Overview: Recombinant fragment, corresponding to amino acids 277-655 of Human FOXO1A with N terminal His tag; 379 amino acids, 49kDa.
Description: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 151 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPR TSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAK MASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSS PGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMS PLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDS PPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQ ASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPH TSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNG YGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGD TLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Sequence Similarities: Contains 1 fork-head DNA-binding domain.
Gene Name: FOXO1 forkhead box O1 [ Homo sapiens ]
Official Symbol: FOXO1
Synonyms: FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma , FOXO1A; forkhead box protein O1; FKH1;
Gene ID: 2308
mRNA Refseq: NM_002015
Protein Refseq: NP_002006
MIM: 136533
Uniprot ID: Q12778
Chromosome Location: 13q14.1
Pathway: AKT phosphorylates targets in the nucleus, organism-specific biosystem; AKT-mediated inactivation of FOXO1A, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: DNA bending activity; double-stranded DNA binding; protein binding; protein kinase binding; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.