Recombinant Human FOXO3 FOXO3-28110TH

Recombinant Human FOXO3

PRODUCTS

Home / Products / Recombinant Human FOXO3

Recombinant Human FOXO3

FOXO3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FOXO3-28110TH
Product Overview : Recombinant full length Human FOXO3A with an N terminal proprietary tag; Predicted MWt 100.1 kDa inclusive of tag.
Description : This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.
Protein length : 673 amino acids
Molecular Weight : 100.100kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPEL QASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIG GGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNL SYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDS NSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTV SGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQ PSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSL NSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFA AQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDF NFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Sequence Similarities : Contains 1 fork-head DNA-binding domain.
Gene Name : FOXO3 forkhead box O3 [ Homo sapiens ]
Official Symbol : FOXO3
Synonyms : FOXO3; forkhead box O3; FKHRL1, FOXO3A; forkhead box protein O3; AF6q21; FOXO2;
Gene ID : 2309
mRNA Refseq : NM_001455
Protein Refseq : NP_001446
MIM : 602681
Uniprot ID : O43524
Chromosome Location : 6q21
Pathway : AKT phosphorylates targets in the nucleus, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class I PI3K signaling events, organism-specific biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem;
Function : DNA bending activity; double-stranded DNA binding; protein binding; protein kinase binding; sequence-specific DNA binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy