Recombinant Human G6PC G6PC-27523TH

Recombinant Human G6PC

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human G6PC

Recombinant Human G6PC

G6PC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : G6PC-27523TH
Product Overview : Recombinant full length Human glucose-6-phosphatase, catalytic subunit with a N-terminal proprietary tag.Mol Wt 65.34 kDa inclusive of tag.
Description : Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys.
Protein length : 357 amino acids
Molecular Weight : 65.340kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLR NAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILF GQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFW AVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVEL VFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
Sequence Similarities : Belongs to the glucose-6-phosphatase family.
Gene Name : G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
Official Symbol : G6PC
Synonyms : G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a;
Gene ID : 2538
mRNA Refseq : NM_000151
Protein Refseq : NP_000142
MIM : 613742
Uniprot ID : P35575
Chromosome Location : 17q21
Pathway : Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem;
Function : glucose-6-phosphatase activity; hydrolase activity; phosphate ion binding; phosphotransferase activity, alcohol group as acceptor;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy