"G6PC" Related Products

Recombinant Human G6PC

Cat.No.: G6PC-27523TH
Product Overview: Recombinant full length Human glucose-6-phosphatase, catalytic subunit with a N-terminal proprietary tag.Mol Wt 65.34 kDa inclusive of tag.
Description: Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys.
Protein length: 357 amino acids
Molecular Weight: 65.340kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLR NAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILF GQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFW AVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVEL VFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
Sequence Similarities: Belongs to the glucose-6-phosphatase family.
Gene Name: G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
Official Symbol: G6PC
Synonyms: G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a;
Gene ID: 2538
mRNA Refseq: NM_000151
Protein Refseq: NP_000142
MIM: 613742
Uniprot ID: P35575
Chromosome Location: 17q21
Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem;
Function: glucose-6-phosphatase activity; hydrolase activity; phosphate ion binding; phosphotransferase activity, alcohol group as acceptor;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.