Recombinant Human G6PC
Cat.No. : | G6PC-27523TH |
Product Overview : | Recombinant full length Human glucose-6-phosphatase, catalytic subunit with a N-terminal proprietary tag.Mol Wt 65.34 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys. |
Protein length : | 357 amino acids |
Molecular Weight : | 65.340kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLR NAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILF GQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFW AVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVEL VFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL |
Sequence Similarities : | Belongs to the glucose-6-phosphatase family. |
Gene Name : | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ] |
Official Symbol : | G6PC |
Synonyms : | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; |
Gene ID : | 2538 |
mRNA Refseq : | NM_000151 |
Protein Refseq : | NP_000142 |
MIM : | 613742 |
Uniprot ID : | P35575 |
Chromosome Location : | 17q21 |
Pathway : | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; |
Function : | glucose-6-phosphatase activity; hydrolase activity; phosphate ion binding; phosphotransferase activity, alcohol group as acceptor; |
Products Types
◆ Recombinant Protein | ||
G6pc-944M | Recombinant Mouse G6pc Protein, His-tagged | +Inquiry |
G6PC-2091R | Recombinant Rat G6PC Protein, His (Fc)-Avi-tagged | +Inquiry |
G6PC-3416M | Recombinant Mouse G6PC Protein, His (Fc)-Avi-tagged | +Inquiry |
G6PC-4613H | Recombinant Human G6PC Protein, GST-tagged | +Inquiry |
G6PC-1542H | Recombinant Human G6PC Protein, His-tagged | +Inquiry |
◆ Lysates | ||
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket