Recombinant Human G6PC

Cat.No. : G6PC-27523TH
Product Overview : Recombinant full length Human glucose-6-phosphatase, catalytic subunit with a N-terminal proprietary tag.Mol Wt 65.34 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 357 amino acids
Description : Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys.
Molecular Weight : 65.340kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLR NAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILF GQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFW AVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVEL VFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
Sequence Similarities : Belongs to the glucose-6-phosphatase family.
Gene Name G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
Official Symbol G6PC
Synonyms G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a;
Gene ID 2538
mRNA Refseq NM_000151
Protein Refseq NP_000142
MIM 613742
Uniprot ID P35575
Chromosome Location 17q21
Pathway Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Carbohydrate digestion and absorption, organism-specific biosystem; Carbohydrate digestion and absorption, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem;
Function glucose-6-phosphatase activity; hydrolase activity; phosphate ion binding; phosphotransferase activity, alcohol group as acceptor;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All G6PC Products

Required fields are marked with *

My Review for All G6PC Products

Required fields are marked with *

0
cart-icon