"GALK2" Related Products

Expand
Expand

Recombinant Human GALK2, His-tagged

Cat.No.: GALK2-28969TH
Product Overview: Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa.
Description: This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL
Gene Name: GALK2 galactokinase 2 [ Homo sapiens ]
Official Symbol: GALK2
Synonyms: GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2;
Gene ID: 2585
mRNA Refseq: NM_001001556
Protein Refseq: NP_001001556
MIM: 137028
Uniprot ID: Q01415
Chromosome Location: 15
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.