"GALM" Related Products

Expand
Expand

Recombinant Human GALM, His-tagged

Cat.No.: GALM-27561TH
Product Overview: Recombinant full length Human Mutarotase with N-terminal His tag; 362 amino acids, MWt 39.9 kDa.
Description: This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
Protein length: 342 amino acids
Conjugation: HIS
Molecular Weight: 39.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
Sequence Similarities: Belongs to the aldose epimerase family.
Gene Name: GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ]
Official Symbol: GALM
Synonyms: GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase;
Gene ID: 130589
mRNA Refseq: NM_138801
Protein Refseq: NP_620156
MIM: 608883
Uniprot ID: Q96C23
Chromosome Location: 2p22.3
Pathway: Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem;
Function: aldose 1-epimerase activity; carbohydrate binding; isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.