Recombinant Human GALM, His-tagged
Cat.No. : | GALM-27561TH |
Product Overview : | Recombinant full length Human Mutarotase with N-terminal His tag; 362 amino acids, MWt 39.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 342 amino acids |
Description : | This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose. |
Conjugation : | HIS |
Molecular Weight : | 39.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA |
Sequence Similarities : | Belongs to the aldose epimerase family. |
Gene Name | GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ] |
Official Symbol | GALM |
Synonyms | GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase; |
Gene ID | 130589 |
mRNA Refseq | NM_138801 |
Protein Refseq | NP_620156 |
MIM | 608883 |
Uniprot ID | Q96C23 |
Chromosome Location | 2p22.3 |
Pathway | Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; |
Function | aldose 1-epimerase activity; carbohydrate binding; isomerase activity; |
◆ Recombinant Proteins | ||
GALM-6177M | Recombinant Mouse GALM Protein | +Inquiry |
GALM-4720H | Recombinant Human GALM protein, His-SUMO-tagged | +Inquiry |
GALM-2119R | Recombinant Rat GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
GALM-3003H | Recombinant Human GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
GALM-911H | Recombinant Human GALM | +Inquiry |
◆ Native Proteins | ||
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALM-6041HCL | Recombinant Human GALM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALM Products
Required fields are marked with *
My Review for All GALM Products
Required fields are marked with *