Recombinant Human GALM, His-tagged
| Cat.No. : | GALM-27561TH |
| Product Overview : | Recombinant full length Human Mutarotase with N-terminal His tag; 362 amino acids, MWt 39.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 342 amino acids |
| Description : | This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose. |
| Conjugation : | HIS |
| Molecular Weight : | 39.900kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA |
| Sequence Similarities : | Belongs to the aldose epimerase family. |
| Gene Name | GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ] |
| Official Symbol | GALM |
| Synonyms | GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase; |
| Gene ID | 130589 |
| mRNA Refseq | NM_138801 |
| Protein Refseq | NP_620156 |
| MIM | 608883 |
| Uniprot ID | Q96C23 |
| Chromosome Location | 2p22.3 |
| Pathway | Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; |
| Function | aldose 1-epimerase activity; carbohydrate binding; isomerase activity; |
| ◆ Recombinant Proteins | ||
| GALM-911H | Recombinant Human GALM | +Inquiry |
| GALM-3003H | Recombinant Human GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
| GALM-2119R | Recombinant Rat GALM Protein, His (Fc)-Avi-tagged | +Inquiry |
| GALM-517Z | Recombinant Zebrafish GALM | +Inquiry |
| GALM-5139HF | Recombinant Full Length Human GALM Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALM-6041HCL | Recombinant Human GALM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALM Products
Required fields are marked with *
My Review for All GALM Products
Required fields are marked with *
