Recombinant Human GALM, His-tagged

• Cat.No.: GALM-27561TH
• Product Overview: Recombinant full length Human Mutarotase with N-terminal His tag; 362 amino acids, MWt 39.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 342 amino acids
• Description: This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
• Conjugation: HIS
• Molecular Weight: 39.900kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
• Sequence Similarities: Belongs to the aldose epimerase family.

Gene Information

• Gene Name: GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ]
• Official Symbol: GALM
• Synonyms: GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase
• Gene ID: 130589
• mRNA Refseq: NM_138801
• Protein Refseq: NP_620156
• MIM: 608883
• Uniprot ID: Q96C23
• Chromosome Location: 2p22.3
• Pathway: Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem
• Function: aldose 1-epimerase activity; carbohydrate binding; isomerase activity