"GBE1" Related Products

Expand

Recombinant Human GBE1

Cat.No.: GBE1-28988TH
Product Overview: Recombinant full length Human GBE1 with a N terminal proprietary tag: predicted molecular weight 103.29 kDa.
Description: The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease).
Protein length: 702 amino acids
Molecular Weight: 103.290kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highest levels found in liver and muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKP YAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHR CADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPW AKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIY ESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI MEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMG IIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHD LWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVT SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLV HTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIP DKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLH KMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESY HYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGT ALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRP YSLLVYIPSRVALILQNVDLPN
Sequence Similarities: Belongs to the glycosyl hydrolase 13 family.
Gene Name: GBE1 glucan (1,4-alpha-), branching enzyme 1 [ Homo sapiens ]
Official Symbol: GBE1
Synonyms: GBE1; glucan (1,4-alpha-), branching enzyme 1; 1,4-alpha-glucan-branching enzyme; Andersen disease; glycogen branching enzyme; glycogen storage disease type IV;
Gene ID: 2632
mRNA Refseq: NM_000158
Protein Refseq: NP_000149
MIM: 607839
Uniprot ID: Q04446
Chromosome Location: 3
Pathway: Glucose metabolism, organism-specific biosystem; Glycogen Metabolism, organism-specific biosystem; Glycogen synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem;
Function: 1,4-alpha-glucan branching enzyme activity; cation binding; hydrolase activity, hydrolyzing O-glycosyl compounds; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.