"GBP1" Related Products

Expand
Expand

Recombinant Human GBP1

Cat.No.: GBP1-28991TH
Product Overview: Recombinant full length Human GBP1 with N terminal proprietary tag; Predicted MWt 91.23 kDa.
Description: Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3.
Protein length: 592 amino acids
Molecular Weight: 91.230kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVV VAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDE NENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDE YLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR PVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTK TLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALA QIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDS EREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQ EASSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKL QDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ TLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQK ERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQL LKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
Sequence Similarities: Belongs to the GBP family.
Gene Name: GBP1 guanylate binding protein 1, interferon-inducible [ Homo sapiens ]
Official Symbol: GBP1
Synonyms: GBP1; guanylate binding protein 1, interferon-inducible; guanylate binding protein 1, interferon inducible, 67kDa; interferon-induced guanylate-binding protein 1;
Gene ID: 2633
mRNA Refseq: NM_002053
Protein Refseq: NP_002044
MIM: 600411
Uniprot ID: P32455
Chromosome Location: 1p22.2
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon gamma signaling, organism-specific biosystem; Type II interferon signaling (IFNG), organism-specific biosystem;
Function: GTP binding; GTPase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.