"GCNT1" Related Products

Expand

Recombinant Human GCNT1

Cat.No.: GCNT1-27452TH
Product Overview: Recombinant full length Human GCNT1 with N-terminal proprietary tag. Predicted MW 73.15kDa.
Description: This gene is a member of the beta-1,6-N-acetylglucosaminyltransferase gene family. It is essential to the formation of Gal beta 1-3(GlcNAc beta 1-6)GalNAc structures and the core 2 O-glycan branch. The gene coding this enzyme was originally mapped to 9q21, but was later localized to 9q13. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein length: 428 amino acids
Molecular Weight: 73.150kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in activated T-lymphocytes and myeloid cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEF VSVRHLELAGENPSSDINCTKVLQGDVNEIQKVKLEILTV KFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSED SYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDE YLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH
Sequence Similarities: Belongs to the glycosyltransferase 14 family.
Gene Name: GCNT1 glucosaminyl (N-acetyl) transferase 1, core 2 [ Homo sapiens ]
Official Symbol: GCNT1
Synonyms: GCNT1; glucosaminyl (N-acetyl) transferase 1, core 2; glucosaminyl (N acetyl) transferase 1, core 2 (beta 1,6 N acetylglucosaminyltransferase) , NACGT2; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase; beta 1; 3 galact
Gene ID: 2650
mRNA Refseq: NM_001097633
Protein Refseq: NP_001091102
MIM: 600391
Uniprot ID: Q02742
Chromosome Location: 9q13
Pathway: Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem;
Function: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.