"GDF7" Related Products

Expand

Recombinant Human GDF7

Cat.No.: GDF7-28992TH
Product Overview: Recombinant full length Human GDF7 , MWt 28kDa.
Description: This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord.
Protein length: 129 amino acids
Molecular Weight: 28.000kDa
Source: E. coli
Biological activity: Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
Form: Liquid
Purity: by SDS-PAGE
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKEL GWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTL LNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYED MVVEACGCR
Sequence Similarities: Belongs to the TGF-beta family.
Gene Name: GDF7 growth differentiation factor 7 [ Homo sapiens ]
Official Symbol: GDF7
Synonyms: GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12;
Gene ID: 151449
mRNA Refseq: NM_182828
Protein Refseq: NP_878248
MIM: 604651
Uniprot ID: Q7Z4P5
Chromosome Location: 2p24.1
Pathway: TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function: cytokine activity; growth factor activity; protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.