"GLRA2" Related Products

Expand
Expand
Expand

Recombinant Human GLRA2

Cat.No.: GLRA2-27147TH
Product Overview: Recombinant fragment corresponding to amino acis 151-252 of Human alpha 2 Glycine Receptor with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag.
Description: The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.
Protein length: 102 amino acids
Molecular Weight: 36.850kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQL ESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG YCTKHYNTGKFTCIEVKFHLER
Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily.
Gene Name: GLRA2 glycine receptor, alpha 2 [ Homo sapiens ]
Official Symbol: GLRA2
Synonyms: GLRA2; glycine receptor, alpha 2; GLR; glycine receptor subunit alpha-2;
Gene ID: 2742
mRNA Refseq: NM_001118885
Protein Refseq: NP_001112357
MIM: 305990
Uniprot ID: P23416
Chromosome Location: Xp22.1-p21.3
Pathway: Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; ion channel activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.