Recombinant Human GLRA2 GLRA2-27147TH

Recombinant Human GLRA2

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GLRA2

Recombinant Human GLRA2

GLRA2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GLRA2-27147TH
Product Overview : Recombinant fragment corresponding to amino acis 151-252 of Human alpha 2 Glycine Receptor with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag.
Description : The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.
Protein length : 102 amino acids
Molecular Weight : 36.850kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQL ESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG YCTKHYNTGKFTCIEVKFHLER
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily.
Gene Name : GLRA2 glycine receptor, alpha 2 [ Homo sapiens ]
Official Symbol : GLRA2
Synonyms : GLRA2; glycine receptor, alpha 2; GLR; glycine receptor subunit alpha-2;
Gene ID : 2742
mRNA Refseq : NM_001118885
Protein Refseq : NP_001112357
MIM : 305990
Uniprot ID : P23416
Chromosome Location : Xp22.1-p21.3
Pathway : Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function : extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; ion channel activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy