Recombinant Human GLRA2

Cat.No. : GLRA2-27147TH
Product Overview : Recombinant fragment corresponding to amino acis 151-252 of Human alpha 2 Glycine Receptor with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 102 amino acids
Description : The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.850kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQL ESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG YCTKHYNTGKFTCIEVKFHLER
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily.
Gene Name GLRA2 glycine receptor, alpha 2 [ Homo sapiens ]
Official Symbol GLRA2
Synonyms GLRA2; glycine receptor, alpha 2; GLR; glycine receptor subunit alpha-2;
Gene ID 2742
mRNA Refseq NM_001118885
Protein Refseq NP_001112357
MIM 305990
Uniprot ID P23416
Chromosome Location Xp22.1-p21.3
Pathway Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; ion channel activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLRA2 Products

Required fields are marked with *

My Review for All GLRA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon