Recombinant Human GLRA2
Cat.No. : | GLRA2-27147TH |
Product Overview : | Recombinant fragment corresponding to amino acis 151-252 of Human alpha 2 Glycine Receptor with a N terminal proprietary tag; predicted MWt 36.85 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 102 amino acids |
Description : | The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.850kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQL ESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG YCTKHYNTGKFTCIEVKFHLER |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily. |
Gene Name | GLRA2 glycine receptor, alpha 2 [ Homo sapiens ] |
Official Symbol | GLRA2 |
Synonyms | GLRA2; glycine receptor, alpha 2; GLR; glycine receptor subunit alpha-2; |
Gene ID | 2742 |
mRNA Refseq | NM_001118885 |
Protein Refseq | NP_001112357 |
MIM | 305990 |
Uniprot ID | P23416 |
Chromosome Location | Xp22.1-p21.3 |
Pathway | Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; glycine binding; ion channel activity; receptor activity; |
◆ Recombinant Proteins | ||
GLRA2-27147TH | Recombinant Human GLRA2 | +Inquiry |
GLRA2-2223R | Recombinant Rat GLRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRA2-1692R | Recombinant Rhesus Macaque GLRA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRA2-2568R | Recombinant Rat GLRA2 Protein | +Inquiry |
Glra2-1366R | Recombinant Rat Glra2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRA2-295HCL | Recombinant Human GLRA2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRA2 Products
Required fields are marked with *
My Review for All GLRA2 Products
Required fields are marked with *
0
Inquiry Basket