"GMPR2" Related Products

Expand
Expand

Recombinant Human GMPR2, His-tagged

Cat.No.: GMPR2-28148TH
Product Overview: Recombinant full length Human GMPR2 (amino acids 1-348) with an N terminal His tag (368 amino acids with the tag).
Description: Guanosine monophosphate reductase (GMPR) Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP.
Protein length: 348 amino acids
Conjugation: HIS
Molecular Weight: 40.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
Gene Name: GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens ]
Official Symbol: GMPR2
Synonyms: GMPR2; guanosine monophosphate reductase 2; GMP reductase 2;
Gene ID: 51292
mRNA Refseq: NM_001002000
Protein Refseq: NP_001002000
MIM: 610781
Uniprot ID: Q9P2T1
Chromosome Location: 14q11.2
Pathway: Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function: GMP reductase activity; metal ion binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.