Recombinant Human GMPR2, His-tagged
Cat.No. : | GMPR2-28148TH |
Product Overview : | Recombinant full length Human GMPR2 (amino acids 1-348) with an N terminal His tag (368 amino acids with the tag). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 348 amino acids |
Description : | Guanosine monophosphate reductase (GMPR) Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. |
Conjugation : | HIS |
Molecular Weight : | 40.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC |
Gene Name | GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens ] |
Official Symbol | GMPR2 |
Synonyms | GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; |
Gene ID | 51292 |
mRNA Refseq | NM_001002000 |
Protein Refseq | NP_001002000 |
MIM | 610781 |
Uniprot ID | Q9P2T1 |
Chromosome Location | 14q11.2 |
Pathway | Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
Function | GMP reductase activity; metal ion binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
GMPR2-5420HF | Recombinant Full Length Human GMPR2 Protein, GST-tagged | +Inquiry |
GMPR2-4845H | Recombinant Human GMPR2 protein, His-SUMO-tagged | +Inquiry |
GMPR2-3751M | Recombinant Mouse GMPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GMPR2-956H | Recombinant Human GMPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GMPR2-5022H | Recombinant Human GMPR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR2-5874HCL | Recombinant Human GMPR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMPR2 Products
Required fields are marked with *
My Review for All GMPR2 Products
Required fields are marked with *