Recombinant Human GNG3

• Cat.No.: GNG3-28960TH
• Product Overview: Recombinant full length Human G gamma3 with N terminal proprietary tag; Predicted MW 33.99 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 75 amino acids
• Description: G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al.
• Molecular Weight: 33.990kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
• Sequence Similarities: Belongs to the G protein gamma family.

Gene Information

• Gene Name: GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
• Official Symbol: GNG3
• Synonyms: GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3
• Gene ID: 2785
• mRNA Refseq: NM_012202
• Protein Refseq: NP_036334
• MIM: 608941
• Uniprot ID: P63215
• Chromosome Location: 11p11
• Pathway: ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem
• Function: G-protein coupled receptor binding; GTPase activity; signal transducer activity; type 1 angiotensin receptor binding