"GNG3" Related Products

Expand

Recombinant Human GNG3

Cat.No.: GNG3-28960TH
Product Overview: Recombinant full length Human G gamma3 with N terminal proprietary tag; Predicted MW 33.99 kDa.
Description: G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al.
Protein length: 75 amino acids
Molecular Weight: 33.990kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Sequence Similarities: Belongs to the G protein gamma family.
Gene Name: GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
Official Symbol: GNG3
Synonyms: GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3;
Gene ID: 2785
mRNA Refseq: NM_012202
Protein Refseq: NP_036334
MIM: 608941
Uniprot ID: P63215
Chromosome Location: 11p11
Pathway: ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem;
Function: G-protein coupled receptor binding; GTPase activity; signal transducer activity; type 1 angiotensin receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.