Recombinant Human GNG3 protein, GST-tagged

Cat.No. : GNG3-301307H
Product Overview : Recombinant Human GNG3 (1-60 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Thr60
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
Official Symbol GNG3
Synonyms GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; NBP gamma-3; guanine nucleotide-binding protein gamma-3 subunit;
Gene ID 2785
mRNA Refseq NM_012202
Protein Refseq NP_036334
MIM 608941
UniProt ID P63215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG3 Products

Required fields are marked with *

My Review for All GNG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon