Recombinant Human GNG3 protein, GST-tagged
Cat.No. : | GNG3-301307H |
Product Overview : | Recombinant Human GNG3 (1-60 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Thr60 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ] |
Official Symbol | GNG3 |
Synonyms | GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; NBP gamma-3; guanine nucleotide-binding protein gamma-3 subunit; |
Gene ID | 2785 |
mRNA Refseq | NM_012202 |
Protein Refseq | NP_036334 |
MIM | 608941 |
UniProt ID | P63215 |
◆ Recombinant Proteins | ||
GNG3-9348Z | Recombinant Zebrafish GNG3 | +Inquiry |
GNG3-301307H | Recombinant Human GNG3 protein, GST-tagged | +Inquiry |
GNG3-3774M | Recombinant Mouse GNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG3-5069H | Recombinant Human GNG3 Protein, GST-tagged | +Inquiry |
GNG3-1725R | Recombinant Rhesus Macaque GNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG3-5852HCL | Recombinant Human GNG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG3 Products
Required fields are marked with *
My Review for All GNG3 Products
Required fields are marked with *
0
Inquiry Basket