"GNPDA1" Related Products

Expand
Expand
Expand

Recombinant Human GNPDA1

Cat.No.: GNPDA1-28076TH
Product Overview: Recombinant full length Human GNPDA1, expressed in Saccharomyces cerevisiae, amino acids 1-289, 33 kDa,
Description: Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLP TGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLP RDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQA ECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSR TRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVM DAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQH PRTVFVCDEDATLELKVKTVKY
Sequence Similarities: Belongs to the glucosamine/galactosamine-6-phosphate isomerase family.
Gene Name: GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ]
Official Symbol: GNPDA1
Synonyms: GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin;
Gene ID: 10007
mRNA Refseq: NM_005471
Protein Refseq: NP_005462
MIM: 601798
Uniprot ID: P46926
Chromosome Location: 5q21
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: glucosamine-6-phosphate deaminase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.