"GRB7" Related Products

Expand

Recombinant Human GRB7

Cat.No.: GRB7-27926TH
Product Overview: Recombinant full length Human GRB7 with N terminal proprietary tag; Predicted MW 84.59 kDa.
Description: The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene.
Protein length: 532 amino acids
Molecular Weight: 84.590kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVK RSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQ SPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLED HESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFP EKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCS EDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQ AWRKKTNHRLSLPMPASGTSLSAAIHRTQLWFHGRISREE SQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILP CLLRHCCTRVAL
Sequence Similarities: Belongs to the GRB7/10/14 family.Contains 1 PH domain.Contains 1 Ras-associating domain.Contains 1 SH2 domain.
Gene Name: GRB7 growth factor receptor-bound protein 7 [ Homo sapiens ]
Official Symbol: GRB7
Synonyms: GRB7; growth factor receptor-bound protein 7;
Gene ID: 2886
mRNA Refseq: NM_001030002
Protein Refseq: NP_001025173
MIM: 601522
Uniprot ID: Q14451
Chromosome Location: 17q12
Pathway: Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem;
Function: RNA binding; SH3/SH2 adaptor activity; identical protein binding; lipid binding; phosphatidylinositol binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.