"GRID1" Related Products

Expand
Expand

Recombinant Human GRID1

Cat.No.: GRID1-28535TH
Product Overview: Recombinant fragment of Human GRID1 with N-terminal proprietary tag. Predicted MW 35.86 kDa.
Description: This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.
Protein length: 93 amino acids
Molecular Weight: 35.860kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.
Gene Name: GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ]
Official Symbol: GRID1
Synonyms: GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; KIAA1220;
Gene ID: 2894
mRNA Refseq: NM_017551
Protein Refseq: NP_060021
MIM: 610659
Uniprot ID: Q9ULK0
Chromosome Location: 10q22
Pathway: Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function: extracellular-glutamate-gated ion channel activity; ion channel activity; ionotropic glutamate receptor activity; receptor activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.