Recombinant Human GRID1

• Cat.No.: GRID1-28535TH
• Product Overview: Recombinant fragment of Human GRID1 with N-terminal proprietary tag. Predicted MW 35.86 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 93 amino acids
• Description: This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.
• Molecular Weight: 35.860kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
• Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.

Gene Information

• Gene Name: GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ]
• Official Symbol: GRID1
• Synonyms: GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; KIAA1220
• Gene ID: 2894
• mRNA Refseq: NM_017551
• Protein Refseq: NP_060021
• MIM: 610659
• Uniprot ID: Q9ULK0
• Chromosome Location: 10q22
• Pathway: Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem
• Function: extracellular-glutamate-gated ion channel activity; ion channel activity; ionotropic glutamate receptor activity; receptor activity; transporter activity