Recombinant Human GRID1

Cat.No. : GRID1-28535TH
Product Overview : Recombinant fragment of Human GRID1 with N-terminal proprietary tag. Predicted MW 35.86 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 93 amino acids
Description : This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.
Molecular Weight : 35.860kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Sequence Similarities : Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.
Gene Name GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ]
Official Symbol GRID1
Synonyms GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; KIAA1220;
Gene ID 2894
mRNA Refseq NM_017551
Protein Refseq NP_060021
MIM 610659
Uniprot ID Q9ULK0
Chromosome Location 10q22
Pathway Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function extracellular-glutamate-gated ion channel activity; ion channel activity; ionotropic glutamate receptor activity; receptor activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRID1 Products

Required fields are marked with *

My Review for All GRID1 Products

Required fields are marked with *

0
cart-icon