Recombinant Human GRID1
Cat.No. : | GRID1-28535TH |
Product Overview : | Recombinant fragment of Human GRID1 with N-terminal proprietary tag. Predicted MW 35.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 93 amino acids |
Description : | This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity. |
Molecular Weight : | 35.860kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily. |
Gene Name | GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ] |
Official Symbol | GRID1 |
Synonyms | GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; KIAA1220; |
Gene ID | 2894 |
mRNA Refseq | NM_017551 |
Protein Refseq | NP_060021 |
MIM | 610659 |
Uniprot ID | Q9ULK0 |
Chromosome Location | 10q22 |
Pathway | Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; |
Function | extracellular-glutamate-gated ion channel activity; ion channel activity; ionotropic glutamate receptor activity; receptor activity; transporter activity; |
◆ Recombinant Proteins | ||
GRID1-7260M | Recombinant Mouse GRID1 Protein | +Inquiry |
GRID1-2692R | Recombinant Rat GRID1 Protein | +Inquiry |
GRID1-3924M | Recombinant Mouse GRID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRID1-2346R | Recombinant Rat GRID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRID1-1796R | Recombinant Rhesus Macaque GRID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRID1-310HCL | Recombinant Human GRID1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRID1 Products
Required fields are marked with *
My Review for All GRID1 Products
Required fields are marked with *
0
Inquiry Basket