Recombinant Human HDAC4, His-tagged HDAC4-28266TH

Recombinant Human HDAC4, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human HDAC4, His-tagged

Recombinant Human HDAC4, His-tagged

HDAC4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HDAC4-28266TH
Product Overview : Recombinant fragment, corresponding to amino acids 556-1084 of Human HDAC4 with a N terminal His tag; MWt 85 kDa:
Description : Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:reconstitution with 125 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQAL LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSS PASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGS SSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEEL QTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRL PCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVAT GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLL QQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRY DDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMG DAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPT PLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEK VMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVT AMASLSVGVKPAEKRPDEEPMEEEPPL
Sequence Similarities : Belongs to the histone deacetylase family. HD type 2 subfamily.
Gene Name : HDAC4 histone deacetylase 4 [ Homo sapiens ]
Official Symbol : HDAC4
Synonyms : HDAC4; histone deacetylase 4; HA6116; HD4; HDAC 4; HDAC A; HDACA; KIAA0288;
Gene ID : 9759
mRNA Refseq : NM_006037
Protein Refseq : NP_006028
MIM : 605314
Uniprot ID : P56524
Chromosome Location : 2q37.3
Pathway : Cell cycle, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class II, organism-specific biosystem;
Function : NAD-dependent histone deacetylase activity (H3-K14 specific); NAD-dependent histone deacetylase activity (H3-K9 specific); NAD-dependent histone deacetylase activity (H4-K16 specific); activating transcription factor binding; histone deacetylase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy