"HDHD2" Related Products

Expand

Recombinant Human HDHD2, His-tagged

Cat.No.: HDHD2-29213TH
Product Overview: Recombinant full length Human HDHD2 with an N terminal His tag; 279 amino acids with tag, Predicted MWt 30.6 kDa.
Description: Haloacid dehalogenase-like hydrolase domain-containing protein 2 is an enzyme that in humans is encoded by the HDHD2 gene.
Protein length: 259 amino acids
Conjugation: HIS
Molecular Weight: 30.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
Sequence Similarities: Belongs to the HAD-like hydrolase superfamily.
Gene Name: HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ]
Official Symbol: HDHD2
Synonyms: HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378;
Gene ID: 84064
mRNA Refseq: NM_032124
Protein Refseq: NP_115500
Uniprot ID: Q9H0R4
Chromosome Location: 18q21.1
Function: hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.