Recombinant Human HDHD2, His-tagged

• Cat.No.: HDHD2-29213TH
• Product Overview: Recombinant full length Human HDHD2 with an N terminal His tag; 279 amino acids with tag, Predicted MWt 30.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 259 amino acids
• Description: Haloacid dehalogenase-like hydrolase domain-containing protein 2 is an enzyme that in humans is encoded by the HDHD2 gene.
• Conjugation: HIS
• Molecular Weight: 30.600kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
• Sequence Similarities: Belongs to the HAD-like hydrolase superfamily.

Gene Information

• Gene Name: HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ]
• Official Symbol: HDHD2
• Synonyms: HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378
• Gene ID: 84064
• mRNA Refseq: NM_032124
• Protein Refseq: NP_115500
• Uniprot ID: Q9H0R4
• Chromosome Location: 18q21.1
• Function: hydrolase activity; metal ion binding