Recombinant Human HDHD2, His-tagged
| Cat.No. : | HDHD2-29213TH |
| Product Overview : | Recombinant full length Human HDHD2 with an N terminal His tag; 279 amino acids with tag, Predicted MWt 30.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 259 amino acids |
| Description : | Haloacid dehalogenase-like hydrolase domain-containing protein 2 is an enzyme that in humans is encoded by the HDHD2 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 30.600kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL |
| Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. |
| Gene Name | HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ] |
| Official Symbol | HDHD2 |
| Synonyms | HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378; |
| Gene ID | 84064 |
| mRNA Refseq | NM_032124 |
| Protein Refseq | NP_115500 |
| Uniprot ID | Q9H0R4 |
| Chromosome Location | 18q21.1 |
| Function | hydrolase activity; metal ion binding; |
| ◆ Recombinant Proteins | ||
| HDHD2-1701H | Recombinant Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 2, His-tagged | +Inquiry |
| HDHD2-934H | Recombinant Human HDHD2, His-tagged | +Inquiry |
| HDHD2-29213TH | Recombinant Human HDHD2, His-tagged | +Inquiry |
| HDHD2-3635H | Recombinant Human HDHD2 Protein (Met1-Leu259), N-His tagged | +Inquiry |
| HDHD2-3443HF | Recombinant Full Length Human HDHD2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDHD2-5595HCL | Recombinant Human HDHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD2 Products
Required fields are marked with *
My Review for All HDHD2 Products
Required fields are marked with *
