Recombinant Human HDHD2, His-tagged

Cat.No. : HDHD2-29213TH
Product Overview : Recombinant full length Human HDHD2 with an N terminal His tag; 279 amino acids with tag, Predicted MWt 30.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 259 amino acids
Description : Haloacid dehalogenase-like hydrolase domain-containing protein 2 is an enzyme that in humans is encoded by the HDHD2 gene.
Conjugation : HIS
Molecular Weight : 30.600kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily.
Gene Name HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ]
Official Symbol HDHD2
Synonyms HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378;
Gene ID 84064
mRNA Refseq NM_032124
Protein Refseq NP_115500
Uniprot ID Q9H0R4
Chromosome Location 18q21.1
Function hydrolase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDHD2 Products

Required fields are marked with *

My Review for All HDHD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon