Native Human HGF

PRODUCTS

Home / Products / Native Human HGF

Native Human HGF

HGF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HGF-29231TH
Product Overview : Synthetic peptide (Human)
Description : Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms.
Form : Lyophilised:Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5 mg/ml. This solution can then be diluted into otheraqueous buffers and stored at 4°C for 1 week or -20°C for future use.
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : hHGF (Human Hepatocyte Growth Factor) is an 80 kDa disulfide-linked heterodimeric protein consisting of the alpha chain (463 amino acids) and the beta chain (234 amino acids):QRKRRNTIHEFKKSAKTTLIKIDPALK IKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQ CLWFPFNSMSSQVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRG KDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQ CSEVECMTCNGESYRGLMGHTESGKICQRWDHQTPHR HKFLPERYPDKGFDDNYCRNPDGGPRPWCYTLDPHTRW EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGT VNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENY CRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQD CYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIF WEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYC PISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPS RDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPE GSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGK VTLNESEICAGAEKIGSQPCEGDYGGPLVCEQHKMR MVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT YKVPQS
Sequence Similarities : Belongs to the peptidase S1 family. Plasminogen subfamily.Contains 4 kringle domains.Contains 1 PAN domain.Contains 1 peptidase S1 domain.
Gene Name : HGF hepatocyte growth factor (hepapoietin A; scatter factor) [ Homo sapiens ]
Official Symbol : HGF
Synonyms : HGF; hepatocyte growth factor (hepapoietin A; scatter factor); deafness, autosomal recessive 39 , DFNB39; hepatocyte growth factor; F TCF; fibroblast derived tumor cytotoxic factor; hepatopoietin A; HGFB; HPTA; lung fibroblast derived mitogen; scatter fac
Gene ID : 3082
mRNA Refseq : NM_000601
Protein Refseq : NP_000592
MIM : 142409
Uniprot ID : P14210
Chromosome Location : 7q21.1
Pathway : Arf6 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Direct p53 effectors, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem;
Function : catalytic activity; growth factor activity; protein binding; protein heterodimerization activity; serine-type endopeptidase activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.