"HIC1" Related Products

Expand
Expand

Recombinant Human HIC1

Cat.No.: HIC1-29312TH
Product Overview: Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa.
Description: This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants.
Protein length: 79 amino acids
Molecular Weight: 34.320kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers.
Gene Name: HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
Official Symbol: HIC1
Synonyms: HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901;
Gene ID: 3090
mRNA Refseq: NM_001098202
Protein Refseq: NP_001091672
MIM: 603825
Uniprot ID: Q14526
Chromosome Location: 17p13.3
Pathway: Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem;
Function: DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.