Recombinant Human HIC1

• Cat.No.: HIC1-29312TH
• Product Overview: Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 79 amino acids
• Description: This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants.
• Molecular Weight: 34.320kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
• Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers.

Gene Information

• Gene Name: HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
• Official Symbol: HIC1
• Synonyms: HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901
• Gene ID: 3090
• mRNA Refseq: NM_001098202
• Protein Refseq: NP_001091672
• MIM: 603825
• Uniprot ID: Q14526
• Chromosome Location: 17p13.3
• Pathway: Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem
• Function: DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding