Recombinant Human HIC1 Protein, GST-tagged

Cat.No. : HIC1-4744H
Product Overview : Human HIC1 partial ORF ( NP_006488.2, 627 a.a. - 705 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2010]
Molecular Mass : 34.32 kDa
AA Sequence : PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
Official Symbol HIC1
Synonyms HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901; zinc finger and BTB domain-containing protein 29; hic-1;
Gene ID 3090
mRNA Refseq NM_001098202
Protein Refseq NP_001091672
MIM 603825
UniProt ID Q14526

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIC1 Products

Required fields are marked with *

My Review for All HIC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon