"HINT1" Related Products

Expand
Expand
Expand

Recombinant Human HINT1, His-tagged

Cat.No.: HINT1-29319TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-126 of Human HINT1 with N terminal His tag, 126 amino acids, 15kDa.
Description: Histidine triad nucleotide-binding protein 1 is a protein that in humans is encoded by the HINT1 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 62 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLA FHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLM IVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL GGRQMHWPPG
Sequence Similarities: Belongs to the HINT family.Contains 1 HIT domain.
Gene Name: HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens ]
Official Symbol: HINT1
Synonyms: HINT1; histidine triad nucleotide binding protein 1; HINT, histidine triad nucleotide binding protein , PRKCNH1; histidine triad nucleotide-binding protein 1; PKCI 1;
Gene ID: 3094
mRNA Refseq: NM_005340
Protein Refseq: NP_005331
MIM: 601314
Uniprot ID: P49773
Chromosome Location: 5q31.2
Function: hydrolase activity; protein kinase C binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.