"HIP1" Related Products

Expand
Expand

Recombinant Human HIP1

Cat.No.: HIP1-26095TH
Product Overview: Recombinant fragment of Human HIP1 with N-terminal proprietary tag. Predicted MW 37.73kDa.
Description: The product of this gene is a membrane-associated protein that colocalizes with huntingtin. This protein has similarities to cytoskeleton proteins and its interaction with huntingtin is thought to play a functional role in the cell filament network. Loss of normal huntingtin-HIP1 interaction in Huntington disease may contribute to a defect in membrane-cytoskeletal integrity in the brain. This gene could help in the understanding of the normal function of huntingtin and also the pathogenesis of Huntington disease. It also has been implicated in the pathogenesis of hematopoietic malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Sequence Similarities: Belongs to the SLA2 family.Contains 1 ENTH (epsin N-terminal homology) domain.Contains 1 I/LWEQ domain.
Gene Name: HIP1 huntingtin interacting protein 1 [ Homo sapiens ]
Official Symbol: HIP1
Synonyms: HIP1; huntingtin interacting protein 1; huntingtin-interacting protein 1; ILWEQ;
Gene ID: 3092
mRNA Refseq: NM_001243198
Protein Refseq: NP_001230127
MIM: 601767
Uniprot ID: O00291
Chromosome Location: 7q11.23
Pathway: Coregulation of Androgen receptor activity, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: actin binding; clathrin binding; phosphatidylinositol binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.