Recombinant Human HIP1
Cat.No. : | HIP1-26095TH |
Product Overview : | Recombinant fragment of Human HIP1 with N-terminal proprietary tag. Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The product of this gene is a membrane-associated protein that colocalizes with huntingtin. This protein has similarities to cytoskeleton proteins and its interaction with huntingtin is thought to play a functional role in the cell filament network. Loss of normal huntingtin-HIP1 interaction in Huntington disease may contribute to a defect in membrane-cytoskeletal integrity in the brain. This gene could help in the understanding of the normal function of huntingtin and also the pathogenesis of Huntington disease. It also has been implicated in the pathogenesis of hematopoietic malignancies. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE |
Sequence Similarities : | Belongs to the SLA2 family.Contains 1 ENTH (epsin N-terminal homology) domain.Contains 1 I/LWEQ domain. |
Gene Name | HIP1 huntingtin interacting protein 1 [ Homo sapiens ] |
Official Symbol | HIP1 |
Synonyms | HIP1; huntingtin interacting protein 1; huntingtin-interacting protein 1; ILWEQ; |
Gene ID | 3092 |
mRNA Refseq | NM_001243198 |
Protein Refseq | NP_001230127 |
MIM | 601767 |
Uniprot ID | O00291 |
Chromosome Location | 7q11.23 |
Pathway | Coregulation of Androgen receptor activity, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | actin binding; clathrin binding; phosphatidylinositol binding; protein binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
HIP1-233HF | Recombinant Full Length Human HIP1 Protein | +Inquiry |
HIP1-13782H | Recombinant Human HIP1 protein, GST-tagged | +Inquiry |
HIP1-1738H | Recombinant Human HIP1 protein, His & T7-tagged | +Inquiry |
HIP1-118H | Recombinant Human HIP1 protein, His-tagged | +Inquiry |
HIP1-3474HF | Recombinant Full Length Human HIP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIP1-788HCL | Recombinant Human HIP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIP1 Products
Required fields are marked with *
My Review for All HIP1 Products
Required fields are marked with *