Recombinant Human HIP1

Cat.No. : HIP1-26095TH
Product Overview : Recombinant fragment of Human HIP1 with N-terminal proprietary tag. Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The product of this gene is a membrane-associated protein that colocalizes with huntingtin. This protein has similarities to cytoskeleton proteins and its interaction with huntingtin is thought to play a functional role in the cell filament network. Loss of normal huntingtin-HIP1 interaction in Huntington disease may contribute to a defect in membrane-cytoskeletal integrity in the brain. This gene could help in the understanding of the normal function of huntingtin and also the pathogenesis of Huntington disease. It also has been implicated in the pathogenesis of hematopoietic malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Ubiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Sequence Similarities : Belongs to the SLA2 family.Contains 1 ENTH (epsin N-terminal homology) domain.Contains 1 I/LWEQ domain.
Gene Name HIP1 huntingtin interacting protein 1 [ Homo sapiens ]
Official Symbol HIP1
Synonyms HIP1; huntingtin interacting protein 1; huntingtin-interacting protein 1; ILWEQ;
Gene ID 3092
mRNA Refseq NM_001243198
Protein Refseq NP_001230127
MIM 601767
Uniprot ID O00291
Chromosome Location 7q11.23
Pathway Coregulation of Androgen receptor activity, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function actin binding; clathrin binding; phosphatidylinositol binding; protein binding; structural constituent of cytoskeleton;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIP1 Products

Required fields are marked with *

My Review for All HIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon