Recombinant Human HIRIP3, His-tagged HIRIP3-27080TH

Recombinant Human HIRIP3, His-tagged

PRODUCTS

Home / Products / Recombinant Human HIRIP3, His-tagged

Recombinant Human HIRIP3, His-tagged

HIRIP3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : HIRIP3-27080TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-183 of Human HIRIP3 with N terminal His tag; 183 amino acids, 21kDa.
Description : The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the protein encoded by this gene binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAREKEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRS HLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKK GKRPPTPCSDPERKRFRFNSESESGSEASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVEESSDEERQRDLPAQRG EESSEEEEKGYKGKTRKKPVVKKQAPG
Gene Name : HIRIP3 HIRA interacting protein 3 [ Homo sapiens ]
Official Symbol : HIRIP3
Synonyms : HIRIP3; HIRA interacting protein 3; HIRA-interacting protein 3;
Gene ID : 8479
mRNA Refseq : NM_001197323
Protein Refseq : NP_001184252
MIM : 603365
Uniprot ID : Q9BW71
Chromosome Location : 16p12.1
Function : protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy