"HIST4H4" Related Products

Expand

Recombinant Human HisT4H4, His-tagged

Cat.No.: HIST4H4-29325TH
Product Overview: Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag.
Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.
Protein length: 103 amino acids
Conjugation: HIS
Molecular Weight: 37.440kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Gene Name: HIST4H4 histone cluster 4, H4 [ Homo sapiens ]
Official Symbol: HIST4H4
Synonyms: HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116;
Gene ID: 121504
mRNA Refseq: NM_175054
Protein Refseq: NP_778224
Uniprot ID: P62805
Chromosome Location: 12p12.3
Pathway: Amyloids, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.