Recombinant Human HNF1B

• Cat.No.: HNF1B-29461TH
• Product Overview: Recombinant fragment of Human TCF2 with N terminal proprietary tag; Predicted MW 37.29kDa.

Specification

• Description: This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 105 amino acids
• Molecular Weight: 37.290kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQ SHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDR QKNPSKEEREALVEECNRAECLQRG
• Sequence Similarities: Belongs to the HNF1 homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HNF1B HNF1 homeobox B [ Homo sapiens ]
• Official Symbol: HNF1B
• Synonyms: HNF1B; HNF1 homeobox B; TCF2, transcription factor 2, hepatic; LF B3; variant hepatic nuclear factor; hepatocyte nuclear factor 1-beta; HNF1beta; LFB3; MODY5; VHNF1
• Gene ID: 6928
• mRNA Refseq: NM_000458
• Protein Refseq: NP_000449
• MIM: 189907
• Uniprot ID: P35680
• Chromosome Location: 17q12
• Pathway: Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem
• Function: DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein homodimerization activity