"HNRNPC" Related Products

Expand
Expand

Recombinant Human HNRNPC, His-tagged

Cat.No.: HNRNPC-31724TH
Product Overview: Recombinant full length Human hnRNP C1 + C2 (amino acids 1-293) with an N terminal His tag; 313aa, 34.5kDa inclusive of tag.
Description: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.
Protein length: 293 amino acids
Conjugation: HIS
Molecular Weight: 34.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Sequence Similarities: Belongs to the RRM HNRPC family. RALY subfamily.Contains 1 RRM (RNA recognition motif) domain.
Gene Name: HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) [ Homo sapiens ]
Official Symbol: HNRNPC
Synonyms: HNRNPC; heterogeneous nuclear ribonucleoprotein C (C1/C2); HNRPC; heterogeneous nuclear ribonucleoproteins C1/C2; hnRNPC;
Gene ID: 3183
mRNA Refseq: NM_001077442
Protein Refseq: NP_001070910
MIM: 164020
Uniprot ID: P07910
Chromosome Location: 14q11
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Spliceosome, organism-specific biosystem;
Function: RNA binding; identical protein binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.