"HOXA1" Related Products

Expand

Recombinant Human HOXA1

Cat.No.: HOXA1-28508TH
Product Overview: Recombinant fragment of Human HOXA1 with N-terminal proprietary tag. Predicted MW 37.62kDa.
Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region.
Protein length: 109 amino acids
Molecular Weight: 37.620kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGD DRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSY SHSSCGPSYGSQNFSAPYSPYALNQEADV
Sequence Similarities: Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name: HOXA1 homeobox A1 [ Homo sapiens ]
Official Symbol: HOXA1
Synonyms: HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1;
Gene ID: 3198
mRNA Refseq: NM_005522
Protein Refseq: NP_005513
MIM: 142955
Uniprot ID: P49639
Chromosome Location: 7p15.2
Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.