Recombinant Human HOXA1 Protein, GST-tagged
| Cat.No. : | HOXA1-4937H |
| Product Overview : | Human HOXA1 full-length ORF ( AAH32547, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq |
| Molecular Mass : | 62.48 kDa |
| AA Sequence : | MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOXA1 homeobox A1 [ Homo sapiens ] |
| Official Symbol | HOXA1 |
| Synonyms | HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1; homeobox 1F; homeo box A1; lab-like protein; Hox 1.6-like protein; homeobox protein Hox-1F; HOX A1 homeodomain protein; BSAS; HOX1; HOX1F; MGC45232; |
| Gene ID | 3198 |
| mRNA Refseq | NM_005522 |
| Protein Refseq | NP_005513 |
| MIM | 142955 |
| UniProt ID | P49639 |
| ◆ Recombinant Proteins | ||
| HOXA1-3705HF | Recombinant Full Length Human HOXA1 Protein, GST-tagged | +Inquiry |
| HOXA1-6949H | Recombinant Human HOXA1 protein, His-tagged | +Inquiry |
| HOXA1-2892R | Recombinant Rat HOXA1 Protein | +Inquiry |
| HOXA1-2547R | Recombinant Rat HOXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HOXA1-28508TH | Recombinant Human HOXA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXA1-5430HCL | Recombinant Human HOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA1 Products
Required fields are marked with *
My Review for All HOXA1 Products
Required fields are marked with *



