"HOXB4" Related Products

Expand

Recombinant Human HOXB4, GST-tagged

Cat.No.: HOXB4-29378TH
Product Overview: Recombinant Human HOXB4(1 a.a. - 60 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 32.34 kDa
AA Sequence: MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: HOXB4 homeobox B4 [ Homo sapiens (human) ]
Official Symbol: HOXB4
Synonyms: HOXB4; homeobox B4; homeo box B4 , HOX2, HOX2F; homeobox protein Hox-B4; homeo box 2F; homeo box B4; homeobox protein Hox-2F; homeobox protein Hox-2.6; HOX2; HOX2F; HOX-2.6
Gene ID: 3214
mRNA Refseq: NM_024015
Protein Refseq: NP_076920
MIM: 142965
UniProt ID: P17483
Chromosome Location: 17q21.32
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.